SCOPe 2.01: Domain d2q1xa1: 2q1x A:8-205

Lineage for d2q1xa1 (2q1x A:8-205)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)

6. Protein Cell-division protein FtsZ [52492] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110501] (5 PDB entries)
   Uniprot O08378

8. Domain d2q1xa1: 2q1x A:8-205 [150000]
   Other proteins in same PDB: d2q1xa2, d2q1xb2
   automatically matched to d1rlua1
   complexed with cit

Details for d2q1xa1

PDB Entry: 2q1x, 2.35 Å

PDB Description: crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with citrate.

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2q1xa1:

Sequence, based on SEQRES records:

>d2q1xa1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

Sequence, based on observed residues (ATOM records):

>d2q1xa1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdsadpev
grkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfs
fegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvqgi
tdlittpglin

Timeline for d2q1xa1:

• d2q1xa1 first appeared in SCOP 1.75
  
• d2q1xa1 appears in SCOPe 2.02
  
• d2q1xa1 appears in the current release, SCOPe 2.08