![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
![]() | Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
![]() | Family a.152.1.1: AhpD [69119] (2 proteins) duplication: two-domain subunits form a helix-swapped trimer |
![]() | Protein Hypothetical protein Bxeno_B2006 [158819] (1 species) |
![]() | Species Burkholderia xenovorans [TaxId:36873] [158820] (1 PDB entry) Uniprot Q13LR5 1-257 |
![]() | Domain d2q0ta1: 2q0t A:1-257 [149990] Other proteins in same PDB: d2q0ta2 |
PDB Entry: 2q0t (more details), 1.7 Å
SCOPe Domain Sequences for d2q0ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q0ta1 a.152.1.1 (A:1-257) Hypothetical protein Bxeno_B2006 {Burkholderia xenovorans [TaxId: 36873]} mtqttpqpdpsrlrdelvrlhgkaspewdslvrldprfvdaylkfagvpqrrnhlddktr afialaadacatqlyapgvarhieralsfgatreelievlelvstigihtsnvgvpvlle vleeeglrkgapplderrqklkaefetnrgywhptweglleldpdlfeayvefssvpwrt gvlspkikefmycafdasathlyvpglklhirnalrygataeelmelleivsvtgihgae lgaplleaalkrsgaaa
Timeline for d2q0ta1: