Lineage for d2q0ta1 (2q0t A:1-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735103Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2735104Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2735105Family a.152.1.1: AhpD [69119] (2 proteins)
    duplication: two-domain subunits form a helix-swapped trimer
  6. 2735129Protein Hypothetical protein Bxeno_B2006 [158819] (1 species)
  7. 2735130Species Burkholderia xenovorans [TaxId:36873] [158820] (1 PDB entry)
    Uniprot Q13LR5 1-257
  8. 2735131Domain d2q0ta1: 2q0t A:1-257 [149990]
    Other proteins in same PDB: d2q0ta2

Details for d2q0ta1

PDB Entry: 2q0t (more details), 1.7 Å

PDB Description: crystal structure of a putative gamma-carboxymuconolactone decarboxylase subunit (bxe_b0980) from burkholderia xenovorans lb400 at 1.70 a resolution
PDB Compounds: (A:) Putative gamma-carboxymuconolactone decarboxylase subunit

SCOPe Domain Sequences for d2q0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q0ta1 a.152.1.1 (A:1-257) Hypothetical protein Bxeno_B2006 {Burkholderia xenovorans [TaxId: 36873]}
mtqttpqpdpsrlrdelvrlhgkaspewdslvrldprfvdaylkfagvpqrrnhlddktr
afialaadacatqlyapgvarhieralsfgatreelievlelvstigihtsnvgvpvlle
vleeeglrkgapplderrqklkaefetnrgywhptweglleldpdlfeayvefssvpwrt
gvlspkikefmycafdasathlyvpglklhirnalrygataeelmelleivsvtgihgae
lgaplleaalkrsgaaa

SCOPe Domain Coordinates for d2q0ta1:

Click to download the PDB-style file with coordinates for d2q0ta1.
(The format of our PDB-style files is described here.)

Timeline for d2q0ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q0ta2