SCOPe 2.07: Domain d2q0ta1: 2q0t A:1-257

Lineage for d2q0ta1 (2q0t A:1-257)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.1: AhpD [69119] (2 protein domains)
   duplication: two-domain subunits form a helix-swapped trimer

6. Protein Hypothetical protein Bxeno_B2006 [158819] (1 species)

7. Species Burkholderia xenovorans [TaxId:36873] [158820] (1 PDB entry)
   Uniprot Q13LR5 1-257

8. Domain d2q0ta1: 2q0t A:1-257 [149990]
   Other proteins in same PDB: d2q0ta2

Details for d2q0ta1

PDB Entry: 2q0t, 1.7 Å

PDB Description: crystal structure of a putative gamma-carboxymuconolactone decarboxylase subunit (bxe_b0980) from burkholderia xenovorans lb400 at 1.70 a resolution

PDB Compounds: (A:) Putative gamma-carboxymuconolactone decarboxylase subunit

SCOPe Domain Sequences for d2q0ta1:

Sequence; same for both SEQRES and ATOM records:

>d2q0ta1 a.152.1.1 (A:1-257) Hypothetical protein Bxeno_B2006 {Burkholderia xenovorans [TaxId: 36873]}
mtqttpqpdpsrlrdelvrlhgkaspewdslvrldprfvdaylkfagvpqrrnhlddktr
afialaadacatqlyapgvarhieralsfgatreelievlelvstigihtsnvgvpvlle
vleeeglrkgapplderrqklkaefetnrgywhptweglleldpdlfeayvefssvpwrt
gvlspkikefmycafdasathlyvpglklhirnalrygataeelmelleivsvtgihgae
lgaplleaalkrsgaaa

Timeline for d2q0ta1:

• d2q0ta1 first appeared in SCOP 1.75
  
• d2q0ta1 appears in SCOPe 2.06