SCOPe 2.08: Domain d2q0jb_: 2q0j B:

Lineage for d2q0jb_ (2q0j B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.14: PqsE-like [160864] (2 proteins)
   part of Pfam PF00753; extended C-terminal region with extra helices

6. Protein Quinolone signal response protein PqsE [160865] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [160866] (2 PDB entries)
   Uniprot Q02IG5 1-301

8. Domain d2q0jb_: 2q0j B: [149988]
   Other proteins in same PDB: d2q0ja2
   automated match to d2q0ja1
   complexed with bez, fe

Details for d2q0jb_

PDB Entry: 2q0j, 2.1 Å

PDB Description: Structure of Pseudomonas Quinolone Signal Response Protein PqsE

PDB Compounds: (B:) Quinolone signal response protein

SCOPe Domain Sequences for d2q0jb_:

Sequence; same for both SEQRES and ATOM records:

>d2q0jb_ d.157.1.14 (B:) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]}
mlrlsapgqldddlcllgdvqvpvfllrlgeaswalveggisrdaelvwadlcrwvadps
qvhywlithkhydhcgllpylcprlpnvqvlasertcqawksesavrvverlnrqllrae
qrlpeacawdalpvravadgewlelgprhrlqvieahghsddhvvfydvrrrrlfcgdal
gefdeaegvwrplvfddmeayleslerlqrlptllqlipghggllrgrlaadgaesayte
clrlcrrllwrqsmgesldelseelhrawggqsvdflpgelhlgsmrrmleilsrqalpl
d

Timeline for d2q0jb_:

• d2q0jb_ first appeared in SCOP 1.75, called d2q0jb1
  
• d2q0jb_ appears in SCOPe 2.07