Lineage for d2q0ia2 (2q0i A:1-298)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997278Family d.157.1.14: PqsE-like [160864] (2 proteins)
    part of Pfam PF00753; extended C-terminal region with extra helices
  6. 2997279Protein Quinolone signal response protein PqsE [160865] (1 species)
  7. 2997280Species Pseudomonas aeruginosa [TaxId:287] [160866] (2 PDB entries)
    Uniprot Q02IG5 1-301
  8. 2997281Domain d2q0ia2: 2q0i A:1-298 [149986]
    Other proteins in same PDB: d2q0ia3
    automated match to d2q0ja1
    complexed with bez, fe

Details for d2q0ia2

PDB Entry: 2q0i (more details), 1.57 Å

PDB Description: Structure of Pseudomonas Quinolone Signal Response Protein PqsE
PDB Compounds: (A:) Quinolone signal response protein

SCOPe Domain Sequences for d2q0ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q0ia2 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]}
mlrlsapgqldddlcllgdvqvpvfllrlgeaswalveggisrdaelvwadlcrwvadps
qvhywlithkhydhcgllpylcprlpnvqvlasertcqawksesavrvverlnrqllrae
qrlpeacawdalpvravadgewlelgprhrlqvieahghsddhvvfydvrrrrlfcgdal
gefdeaegvwrplvfddmeayleslerlqrlptllqlipghggllrgrlaadgaesayte
clrlcrrllwrqsmgesldelseelhrawggqsvdflpgelhlgsmrrmleilsrqal

SCOPe Domain Coordinates for d2q0ia2:

Click to download the PDB-style file with coordinates for d2q0ia2.
(The format of our PDB-style files is described here.)

Timeline for d2q0ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q0ia3