SCOPe 2.08: Domain d2q09a2: 2q09 A:66-366

Lineage for d2q09a2 (2q09 A:66-366)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins)
   automatically mapped to Pfam PF13147

6. Protein Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 [159403] (1 species)

7. Species Environmental samples [TaxId:33858] [159404] (2 PDB entries)
   marine metagenome

8. Domain d2q09a2: 2q09 A:66-366 [149985]
   Other proteins in same PDB: d2q09a1
   automatically matched to 2OOF A:66-366
   complexed with di6, fe

Details for d2q09a2

PDB Entry: 2q09, 1.97 Å

PDB Description: crystal structure of imidazolonepropionase from environmental sample with bound inhibitor 3-(2,5-dioxo-imidazolidin-4-yl)-propionic acid

PDB Compounds: (A:) Imidazolonepropionase

SCOPe Domain Sequences for d2q09a2:

Sequence; same for both SEQRES and ATOM records:

>d2q09a2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples [TaxId: 33858]}
pglidchthlifagsraeefelrqkgvpyaeiarkgggiistvratraasedqlfelalp
rvksliregvttveiksgygltledelkmlrvarrlgealpirvkttllaahavppeyrd
dpdswveticqeiipaaaeagladavdvfcehigfslaqteqvylaadqyglavkghmdq
lsnlggstlaanfgalsvdhleyldpegiqalahrgvvatllptafyflketklppvval
rkagvpmavssdinpgtapivslrmamnmactlfgltpveamagvtrhaaralgeqeqlg
q

Timeline for d2q09a2:

• d2q09a2 first appeared in SCOP 1.75
  
• d2q09a2 appears in SCOPe 2.07