Lineage for d2q09a1 (2q09 A:4-65,A:367-407)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073462Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2073463Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2073691Family b.92.1.10: Imidazolonepropionase-like [159347] (3 protein domains)
  6. 2073703Protein Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 [159351] (1 species)
  7. 2073704Species Environmental samples [TaxId:33858] [159352] (2 PDB entries)
    marine metagenome
  8. 2073705Domain d2q09a1: 2q09 A:4-65,A:367-407 [149984]
    Other proteins in same PDB: d2q09a2
    automatically matched to 2OOF A:3-65,A:367-407
    complexed with di6, fe

Details for d2q09a1

PDB Entry: 2q09 (more details), 1.97 Å

PDB Description: Crystal structure of Imidazolonepropionase from environmental sample with bound inhibitor 3-(2,5-Dioxo-imidazolidin-4-yl)-propionic acid
PDB Compounds: (A:) Imidazolonepropionase

SCOPe Domain Sequences for d2q09a1:

Sequence, based on SEQRES records: (download)

>d2q09a1 b.92.1.10 (A:4-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples [TaxId: 33858]}
ncervwlnvtpatlrsdladygllephalgvhegrihalvpmqdlkgpypahwqdmkgkl
vtXlrvgmladflvwncghpaelsyligvdqlvsrvvngeetlh

Sequence, based on observed residues (ATOM records): (download)

>d2q09a1 b.92.1.10 (A:4-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples [TaxId: 33858]}
ncervwlnvtpatlrsdladygllephalgvhegrihalvpmqdlkypahwqdmkgklvt
Xlrvgmladflvwncghpaelsyligvdqlvsrvvngeetlh

SCOPe Domain Coordinates for d2q09a1:

Click to download the PDB-style file with coordinates for d2q09a1.
(The format of our PDB-style files is described here.)

Timeline for d2q09a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q09a2