![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins) |
![]() | Protein Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 [159351] (1 species) |
![]() | Species Environmental samples [TaxId:33858] [159352] (2 PDB entries) marine metagenome |
![]() | Domain d2q09a1: 2q09 A:4-65,A:367-407 [149984] Other proteins in same PDB: d2q09a2 automatically matched to 2OOF A:3-65,A:367-407 complexed with di6, fe |
PDB Entry: 2q09 (more details), 1.97 Å
SCOPe Domain Sequences for d2q09a1:
Sequence, based on SEQRES records: (download)
>d2q09a1 b.92.1.10 (A:4-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples [TaxId: 33858]} ncervwlnvtpatlrsdladygllephalgvhegrihalvpmqdlkgpypahwqdmkgkl vtXlrvgmladflvwncghpaelsyligvdqlvsrvvngeetlh
>d2q09a1 b.92.1.10 (A:4-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples [TaxId: 33858]} ncervwlnvtpatlrsdladygllephalgvhegrihalvpmqdlkypahwqdmkgklvt Xlrvgmladflvwncghpaelsyligvdqlvsrvvngeetlh
Timeline for d2q09a1: