SCOP 1.75: Domain d2q07a3: 2q07 A:394-459

Lineage for d2q07a3 (2q07 A:394-459)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.6: Pre-PUA domain [88802] (5 families)
   this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins

5. Family d.17.6.5: AF0587 pre C-terminal domain-like [160053] (1 protein)
   PfamB PB006016

6. Protein Uncharacterized protein AF0587 [160054] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [160055] (1 PDB entry)
   Uniprot O29668 394-459

8. Domain d2q07a3: 2q07 A:394-459 [149983]
   Other proteins in same PDB: d2q07a1, d2q07a2

Details for d2q07a3

PDB Entry: 2q07, 2.04 Å

PDB Description: crystal structure of af0587, a protein of unknown function

PDB Compounds: (A:) Uncharacterized protein AF0587

SCOP Domain Sequences for d2q07a3:

Sequence; same for both SEQRES and ATOM records:

>d2q07a3 d.17.6.5 (A:394-459) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]}
kvdlyrrilehmlsyqfgitwsgkvagrypelellegkkrlarvdriygmldiyekiaay
llekni

Timeline for d2q07a3:

• d2q07a3 is new in SCOP 1.75
  
• d2q07a3 appears in SCOPe 2.01
  
• d2q07a3 appears in the current release, SCOPe 2.08