Lineage for d2q07a3 (2q07 A:394-459)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2937437Superfamily d.17.6: Pre-PUA domain [88802] (5 families) (S)
    this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins
  5. 2937464Family d.17.6.5: AF0587 pre C-terminal domain-like [160053] (1 protein)
    PfamB PB006016
  6. 2937465Protein Uncharacterized protein AF0587 [160054] (1 species)
  7. 2937466Species Archaeoglobus fulgidus [TaxId:2234] [160055] (1 PDB entry)
    Uniprot O29668 394-459
  8. 2937467Domain d2q07a3: 2q07 A:394-459 [149983]
    Other proteins in same PDB: d2q07a1, d2q07a2

Details for d2q07a3

PDB Entry: 2q07 (more details), 2.04 Å

PDB Description: crystal structure of af0587, a protein of unknown function
PDB Compounds: (A:) Uncharacterized protein AF0587

SCOPe Domain Sequences for d2q07a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q07a3 d.17.6.5 (A:394-459) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]}
kvdlyrrilehmlsyqfgitwsgkvagrypelellegkkrlarvdriygmldiyekiaay
llekni

SCOPe Domain Coordinates for d2q07a3:

Click to download the PDB-style file with coordinates for d2q07a3.
(The format of our PDB-style files is described here.)

Timeline for d2q07a3: