![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.6: Pre-PUA domain [88802] (5 families) ![]() this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins |
![]() | Family d.17.6.5: AF0587 pre C-terminal domain-like [160053] (1 protein) PfamB PB006016 |
![]() | Protein Uncharacterized protein AF0587 [160054] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [160055] (1 PDB entry) Uniprot O29668 394-459 |
![]() | Domain d2q07a3: 2q07 A:394-459 [149983] Other proteins in same PDB: d2q07a1, d2q07a2 |
PDB Entry: 2q07 (more details), 2.04 Å
SCOPe Domain Sequences for d2q07a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q07a3 d.17.6.5 (A:394-459) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]} kvdlyrrilehmlsyqfgitwsgkvagrypelellegkkrlarvdriygmldiyekiaay llekni
Timeline for d2q07a3: