Lineage for d2q07a2 (2q07 A:244-393)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855125Family c.18.1.4: AF0587 domain-like [159464] (1 protein)
    a middle domain in the founder protein
  6. 2855126Protein Uncharacterized protein AF0587 [159465] (1 species)
  7. 2855127Species Archaeoglobus fulgidus [TaxId:2234] [159466] (1 PDB entry)
    Uniprot O29668 244-383
  8. 2855128Domain d2q07a2: 2q07 A:244-393 [149982]
    Other proteins in same PDB: d2q07a1, d2q07a3

Details for d2q07a2

PDB Entry: 2q07 (more details), 2.04 Å

PDB Description: crystal structure of af0587, a protein of unknown function
PDB Compounds: (A:) Uncharacterized protein AF0587

SCOPe Domain Sequences for d2q07a2:

Sequence, based on SEQRES records: (download)

>d2q07a2 c.18.1.4 (A:244-393) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]}
ryfferalecykpfsdtvlllpctarkpyltsrthralrskvkvnvneiiissplvvpre
fellypavnydtpvtghwseeevsfvagwlkrfiekggfrkvvahvtggyrkvvervede
veaevvytaekdvlsdesierlkqeieskg

Sequence, based on observed residues (ATOM records): (download)

>d2q07a2 c.18.1.4 (A:244-393) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]}
ryfferalecykpfsdtvlllpctarkpyltsrthralrskvkvnvneiiissplvvpre
fellhwseeevsfvagwlkrfiekggfrkvvahvtggyrkvvervedeveaevvytaekd
vlsdesierlkqeieskg

SCOPe Domain Coordinates for d2q07a2:

Click to download the PDB-style file with coordinates for d2q07a2.
(The format of our PDB-style files is described here.)

Timeline for d2q07a2: