![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.159: AOC barrel-like [141492] (2 superfamilies) barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds |
![]() | Superfamily b.159.2: SO1590-like [159238] (1 family) ![]() automatically mapped to Pfam PF11528 |
![]() | Family b.159.2.1: SO1590-like [159239] (2 proteins) |
![]() | Protein Uncharacterized protein Sden_2034 [159242] (1 species) |
![]() | Species Shewanella denitrificans [TaxId:192073] [159243] (1 PDB entry) Uniprot Q12ML0 5-137 |
![]() | Domain d2q03b_: 2q03 B: [149980] automated match to d2q03a1 complexed with gol |
PDB Entry: 2q03 (more details), 1.8 Å
SCOPe Domain Sequences for d2q03b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q03b_ b.159.2.1 (B:) Uncharacterized protein Sden_2034 {Shewanella denitrificans [TaxId: 192073]} tklqtiigmfqitawdetsyfesdngakltqavitqsyqgvlqghseirylmsyqdnana tfvgfehftgslgdkkgsfilqhkglfaagvassefelversatgdfvhlvgkghfvste ngqanyqitlq
Timeline for d2q03b_: