Lineage for d2q03a1 (2q03 A:5-137)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825302Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 2825375Superfamily b.159.2: SO1590-like [159238] (1 family) (S)
    automatically mapped to Pfam PF11528
  5. 2825376Family b.159.2.1: SO1590-like [159239] (2 proteins)
  6. 2825381Protein Uncharacterized protein Sden_2034 [159242] (1 species)
  7. 2825382Species Shewanella denitrificans [TaxId:192073] [159243] (1 PDB entry)
    Uniprot Q12ML0 5-137
  8. 2825383Domain d2q03a1: 2q03 A:5-137 [149979]
    complexed with gol

Details for d2q03a1

PDB Entry: 2q03 (more details), 1.8 Å

PDB Description: crystal structure of uncharacterized protein (yp_563039.1) from shewanella denitrificans os217 at 1.80 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2q03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q03a1 b.159.2.1 (A:5-137) Uncharacterized protein Sden_2034 {Shewanella denitrificans [TaxId: 192073]}
tklqtiigmfqitawdetsyfesdngakltqavitqsyqgvlqghseirylmsyqdnana
tfvgfehftgslgdkkgsfilqhkglfaagvassefelversatgdfvhlvgkghfvste
ngqanyqitlqds

SCOPe Domain Coordinates for d2q03a1:

Click to download the PDB-style file with coordinates for d2q03a1.
(The format of our PDB-style files is described here.)

Timeline for d2q03a1: