SCOPe 2.05: Domain d2pzxd1: 2pzx D:1-188

Lineage for d2pzxd1 (2pzx D:1-188)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.102: Methuselah ectodomain [63876] (1 superfamily)
   complex fold

4. Superfamily b.102.1: Methuselah ectodomain [63877] (1 family)
   duplication: contains two similar sub domains connected by a structured linker
   automatically mapped to Pfam PF06652

5. Family b.102.1.1: Methuselah ectodomain [63878] (1 protein)

6. Protein Methuselah ectodomain [63879] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63880] (2 PDB entries)

8. Domain d2pzxd1: 2pzx D:1-188 [149976]
   automatically matched to d1fjra_

Details for d2pzxd1

PDB Entry: 2pzx, 3.5 Å

PDB Description: structure of the methuselah ectodomain with peptide inhibitor

PDB Compounds: (D:) G-protein coupled receptor Mth

SCOPe Domain Sequences for d2pzxd1:

Sequence; same for both SEQRES and ATOM records:

>d2pzxd1 b.102.1.1 (D:1-188) Methuselah ectodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
aphncliv

Timeline for d2pzxd1:

• d2pzxd1 first appeared in SCOP 1.75
  
• d2pzxd1 appears in SCOPe 2.04
  
• d2pzxd1 appears in SCOPe 2.06
  
• d2pzxd1 appears in the current release, SCOPe 2.08