| Class b: All beta proteins [48724] (174 folds) |
| Fold b.102: Methuselah ectodomain [63876] (1 superfamily) complex fold |
Superfamily b.102.1: Methuselah ectodomain [63877] (1 family) ![]() duplication: contains two similar sub domains connected by a structured linker |
| Family b.102.1.1: Methuselah ectodomain [63878] (1 protein) |
| Protein Methuselah ectodomain [63879] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63880] (2 PDB entries) |
| Domain d2pzxb1: 2pzx B:1-188 [149974] automatically matched to d1fjra_ |
PDB Entry: 2pzx (more details), 3.5 Å
SCOP Domain Sequences for d2pzxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pzxb1 b.102.1.1 (B:1-188) Methuselah ectodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
aphncliv
Timeline for d2pzxb1: