Lineage for d2pzxb1 (2pzx B:1-188)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820783Fold b.102: Methuselah ectodomain [63876] (1 superfamily)
    complex fold
  4. 2820784Superfamily b.102.1: Methuselah ectodomain [63877] (1 family) (S)
    duplication: contains two similar sub domains connected by a structured linker
    automatically mapped to Pfam PF06652
  5. 2820785Family b.102.1.1: Methuselah ectodomain [63878] (1 protein)
  6. 2820786Protein Methuselah ectodomain [63879] (1 species)
  7. 2820787Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63880] (2 PDB entries)
  8. 2820791Domain d2pzxb1: 2pzx B:1-188 [149974]
    automatically matched to d1fjra_

Details for d2pzxb1

PDB Entry: 2pzx (more details), 3.5 Å

PDB Description: structure of the methuselah ectodomain with peptide inhibitor
PDB Compounds: (B:) G-protein coupled receptor Mth

SCOPe Domain Sequences for d2pzxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzxb1 b.102.1.1 (B:1-188) Methuselah ectodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
aphncliv

SCOPe Domain Coordinates for d2pzxb1:

Click to download the PDB-style file with coordinates for d2pzxb1.
(The format of our PDB-style files is described here.)

Timeline for d2pzxb1: