Lineage for d1hbib_ (1hbi B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1715983Protein Hemoglobin I [46464] (2 species)
  7. 1715984Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries)
  8. 1716030Domain d1hbib_: 1hbi B: [14997]
    complexed with hem, oxy

Details for d1hbib_

PDB Entry: 1hbi (more details), 1.7 Å

PDB Description: crystal structure of oxygenated scapharca dimeric hemoglobin at 1.7 angstroms resolution
PDB Compounds: (B:) hemoglobin (oxy)

SCOPe Domain Sequences for d1hbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbib_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d1hbib_:

Click to download the PDB-style file with coordinates for d1hbib_.
(The format of our PDB-style files is described here.)

Timeline for d1hbib_: