Lineage for d1hbib_ (1hbi B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686141Protein Hemoglobin I [46464] (2 species)
  7. 2686142Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)
  8. 2686176Domain d1hbib_: 1hbi B: [14997]
    complexed with hem, oxy

Details for d1hbib_

PDB Entry: 1hbi (more details), 1.7 Å

PDB Description: crystal structure of oxygenated scapharca dimeric hemoglobin at 1.7 angstroms resolution
PDB Compounds: (B:) hemoglobin (oxy)

SCOPe Domain Sequences for d1hbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbib_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d1hbib_:

Click to download the PDB-style file with coordinates for d1hbib_.
(The format of our PDB-style files is described here.)

Timeline for d1hbib_: