Lineage for d2pzsa2 (2pzs A:188-575)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622071Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2622316Protein phi29 DNA polymerase [118193] (1 species)
  7. 2622317Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
    Uniprot P03680
  8. 2622329Domain d2pzsa2: 2pzs A:188-575 [149966]
    Other proteins in same PDB: d2pzsa1, d2pzsb1, d2pzsc1, d2pzsd1
    automated match to d1xhxa2
    protein/DNA complex

Details for d2pzsa2

PDB Entry: 2pzs (more details), 2.6 Å

PDB Description: phi29 dna polymerase complexed with primer-template dna (post- translocation binary complex)
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2pzsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzsa2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

SCOPe Domain Coordinates for d2pzsa2:

Click to download the PDB-style file with coordinates for d2pzsa2.
(The format of our PDB-style files is described here.)

Timeline for d2pzsa2: