Lineage for d2pzsa1 (2pzs A:5-187)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2494311Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2494476Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)
  7. 2494477Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
    Uniprot P03680
  8. 2494489Domain d2pzsa1: 2pzs A:5-187 [149965]
    Other proteins in same PDB: d2pzsa2, d2pzsb2, d2pzsc2, d2pzsd2
    automated match to d1xhxa1
    protein/DNA complex

Details for d2pzsa1

PDB Entry: 2pzs (more details), 2.6 Å

PDB Description: phi29 dna polymerase complexed with primer-template dna (post- translocation binary complex)
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2pzsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzsa1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

SCOPe Domain Coordinates for d2pzsa1:

Click to download the PDB-style file with coordinates for d2pzsa1.
(The format of our PDB-style files is described here.)

Timeline for d2pzsa1: