Lineage for d2pzdb_ (2pzd B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396113Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2396114Protein automated matches [190436] (9 species)
    not a true protein
  7. 2396128Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)
  8. 2396274Domain d2pzdb_: 2pzd B: [149963]
    automated match to d2p3wa_
    complexed with edo

Details for d2pzdb_

PDB Entry: 2pzd (more details), 2.75 Å

PDB Description: crystal structure of the htra2/omi pdz domain bound to a phage-derived ligand (wtmfwv)
PDB Compounds: (B:) Serine protease HTRA2

SCOPe Domain Sequences for d2pzdb_:

Sequence, based on SEQRES records: (download)

>d2pzdb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtegggwtmfwv

Sequence, based on observed residues (ATOM records): (download)

>d2pzdb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevtgwtmfwv

SCOPe Domain Coordinates for d2pzdb_:

Click to download the PDB-style file with coordinates for d2pzdb_.
(The format of our PDB-style files is described here.)

Timeline for d2pzdb_: