SCOPe 2.08: Domain d1hbia_: 1hbi A:

Lineage for d1hbia_ (1hbi A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)

8. Domain d1hbia_: 1hbi A: [14996]
   complexed with hem, oxy

Details for d1hbia_

PDB Entry: 1hbi, 1.7 Å

PDB Description: crystal structure of oxygenated scapharca dimeric hemoglobin at 1.7 angstroms resolution

PDB Compounds: (A:) hemoglobin (oxy)

SCOPe Domain Sequences for d1hbia_:

Sequence; same for both SEQRES and ATOM records:

>d1hbia_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d1hbia_:

• d1hbia_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbia_ appears in SCOPe 2.07