SCOPe 2.06: Domain d2pyqd2: 2pyq D:1-113

Lineage for d2pyqd2 (2pyq D:1-113)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.279: Jann4075-like [158586] (1 superfamily)
   core: 5 helices; the C-terminal helix is surrounded by the others; similarity to some EF-hand domains

4. Superfamily a.279.1: Jann4075-like [158587] (1 family)
   automatically mapped to Pfam PF11015

5. Family a.279.1.1: Jann4075-like [158588] (1 protein)

6. Protein Uncharacterized protein Jann4075 [158589] (1 species)

7. Species Jannaschia sp. CCS1 [TaxId:290400] [158590] (1 PDB entry)
   Uniprot Q28JX0 1-113

8. Domain d2pyqd2: 2pyq D:1-113 [149956]
   Other proteins in same PDB: d2pyqa2, d2pyqb3, d2pyqc3, d2pyqd3
   automated match to d2pyqa1
   complexed with pg4

Details for d2pyqd2

PDB Entry: 2pyq, 1.5 Å

PDB Description: crystal structure of a duf2853 member protein (jann_4075) from jannaschia sp. ccs1 at 1.500 a resolution

PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d2pyqd2:

Sequence; same for both SEQRES and ATOM records:

>d2pyqd2 a.279.1.1 (D:1-113) Uncharacterized protein Jann4075 {Jannaschia sp. CCS1 [TaxId: 290400]}
mgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletikk
nflmkklgladseslmggiqsvietygrsernkyravvyymltkhfgkesvyg

Timeline for d2pyqd2:

• d2pyqd2 first appeared in SCOP 1.75, called d2pyqd1
  
• d2pyqd2 was called d2pyqd_ in SCOPe 2.05
  
• d2pyqd2 appears in SCOPe 2.07
  
• d2pyqd2 appears in the current release, SCOPe 2.08