Lineage for d2pyqd1 (2pyq D:1-113)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781284Fold a.279: Jann4075-like [158586] (1 superfamily)
    core: 5 helices; the C-terminal helix is surrounded by the others; similarity to some EF-hand domains
  4. 781285Superfamily a.279.1: Jann4075-like [158587] (1 family) (S)
  5. 781286Family a.279.1.1: Jann4075-like [158588] (1 protein)
  6. 781287Protein Uncharacterized protein Jann4075 [158589] (1 species)
  7. 781288Species Jannaschia sp. ccs1 [TaxId:290400] [158590] (1 PDB entry)
    Uniprot Q28JX0 1-113
  8. 781292Domain d2pyqd1: 2pyq D:1-113 [149956]
    automatically matched to 2PYQ A:1-113
    complexed with pg4

Details for d2pyqd1

PDB Entry: 2pyq (more details), 1.5 Å

PDB Description: crystal structure of a duf2853 member protein (jann_4075) from jannaschia sp. ccs1 at 1.500 a resolution
PDB Compounds: (D:) Uncharacterized protein

SCOP Domain Sequences for d2pyqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pyqd1 a.279.1.1 (D:1-113) Uncharacterized protein Jann4075 {Jannaschia sp. ccs1 [TaxId: 290400]}
mgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletikk
nflmkklgladseslmggiqsvietygrsernkyravvyymltkhfgkesvyg

SCOP Domain Coordinates for d2pyqd1:

Click to download the PDB-style file with coordinates for d2pyqd1.
(The format of our PDB-style files is described here.)

Timeline for d2pyqd1: