| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.279: Jann4075-like [158586] (1 superfamily) core: 5 helices; the C-terminal helix is surrounded by the others; similarity to some EF-hand domains |
Superfamily a.279.1: Jann4075-like [158587] (1 family) ![]() automatically mapped to Pfam PF11015 |
| Family a.279.1.1: Jann4075-like [158588] (1 protein) |
| Protein Uncharacterized protein Jann4075 [158589] (1 species) |
| Species Jannaschia sp. CCS1 [TaxId:290400] [158590] (1 PDB entry) Uniprot Q28JX0 1-113 |
| Domain d2pyqd2: 2pyq D:1-113 [149956] Other proteins in same PDB: d2pyqa2, d2pyqb3, d2pyqc3, d2pyqd3 automated match to d2pyqa1 complexed with pg4 |
PDB Entry: 2pyq (more details), 1.5 Å
SCOPe Domain Sequences for d2pyqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyqd2 a.279.1.1 (D:1-113) Uncharacterized protein Jann4075 {Jannaschia sp. CCS1 [TaxId: 290400]}
mgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletikk
nflmkklgladseslmggiqsvietygrsernkyravvyymltkhfgkesvyg
Timeline for d2pyqd2: