![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.279: Jann4075-like [158586] (1 superfamily) core: 5 helices; the C-terminal helix is surrounded by the others; similarity to some EF-hand domains |
![]() | Superfamily a.279.1: Jann4075-like [158587] (1 family) ![]() automatically mapped to Pfam PF11015 |
![]() | Family a.279.1.1: Jann4075-like [158588] (1 protein) |
![]() | Protein Uncharacterized protein Jann4075 [158589] (1 species) |
![]() | Species Jannaschia sp. CCS1 [TaxId:290400] [158590] (1 PDB entry) Uniprot Q28JX0 1-113 |
![]() | Domain d2pyqa1: 2pyq A:1-113 [149953] Other proteins in same PDB: d2pyqa2, d2pyqb3, d2pyqc3, d2pyqd3 complexed with pg4 |
PDB Entry: 2pyq (more details), 1.5 Å
SCOPe Domain Sequences for d2pyqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyqa1 a.279.1.1 (A:1-113) Uncharacterized protein Jann4075 {Jannaschia sp. CCS1 [TaxId: 290400]} mgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletikk nflmkklgladseslmggiqsvietygrsernkyravvyymltkhfgkesvyg
Timeline for d2pyqa1: