Lineage for d2pyof_ (2pyo F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698549Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158387] (2 PDB entries)
  8. 2698555Domain d2pyof_: 2pyo F: [149952]
    Other proteins in same PDB: d2pyoa_, d2pyoc_, d2pyod_, d2pyoe_, d2pyog_, d2pyoh_
    automated match to d1kx5b_
    protein/DNA complex; complexed with cl, mn

Details for d2pyof_

PDB Entry: 2pyo (more details), 2.43 Å

PDB Description: Drosophila nucleosome core
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d2pyof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pyof_ a.22.1.1 (F:) Histone H4 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
akrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyte
hakrktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d2pyof_:

Click to download the PDB-style file with coordinates for d2pyof_.
(The format of our PDB-style files is described here.)

Timeline for d2pyof_: