SCOPe 2.06: Domain d2pyjb1: 2pyj B:3-187

Lineage for d2pyjb1 (2pyj B:3-187)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
   Uniprot P03680

8. Domain d2pyjb1: 2pyj B:3-187 [149945]
   Other proteins in same PDB: d2pyja2, d2pyjb2
   automated match to d1xhxa1
   protein/DNA complex; complexed with dgt, edo, mg, mn

Details for d2pyjb1

PDB Entry: 2pyj, 2.03 Å

PDB Description: phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)

PDB Compounds: (B:) DNA polymerase

SCOPe Domain Sequences for d2pyjb1:

Sequence; same for both SEQRES and ATOM records:

>d2pyjb1 c.55.3.5 (B:3-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
hmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhn
lkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviyds
lkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfk
qgldr

Timeline for d2pyjb1:

• d2pyjb1 first appeared in SCOP 1.75
  
• d2pyjb1 appears in SCOPe 2.05
  
• d2pyjb1 appears in SCOPe 2.07
  
• d2pyjb1 appears in the current release, SCOPe 2.08