SCOPe 2.02: Domain d2pyeb_: 2pye B:

Lineage for d2pyeb_ (2pye B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (333 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d2pyeb_: 2pye B: [149941]
   Other proteins in same PDB: d2pyea1, d2pyea2
   automated match to d1a9bb_
   complexed with 7pe, gol, pge, so4

Details for d2pyeb_

PDB Entry: 2pye, 2.3 Å

PDB Description: Crystal Structures of High Affinity Human T-Cell Receptors Bound to pMHC RevealNative Diagonal Binding Geometry TCR Clone C5C1 Complexed with MHC

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d2pyeb_:

Sequence; same for both SEQRES and ATOM records:

>d2pyeb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpcivkwdrdm

Timeline for d2pyeb_:

• d2pyeb_ first appeared in SCOP 1.75, called d2pyeb1
  
• d2pyeb_ appears in SCOPe 2.01
  
• d2pyeb_ appears in SCOPe 2.03
  
• d2pyeb_ appears in the current release, SCOPe 2.08, called d2pyeb2