| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin I [46464] (2 species) |
| Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries) |
| Domain d7hbia_: 7hbi A: [14994] complexed with cmo, hem; mutant |
PDB Entry: 7hbi (more details), 1.6 Å
SCOPe Domain Sequences for d7hbia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7hbia_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsivlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal
Timeline for d7hbia_: