Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins) |
Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species) |
Species Escherichia coli [TaxId:562] [68926] (10 PDB entries) |
Domain d2py7x2: 2py7 X:6-227 [149934] Other proteins in same PDB: d2py7x1 automatically matched to d1ayla2 complexed with atp, mg, mn; mutant |
PDB Entry: 2py7 (more details), 2.2 Å
SCOPe Domain Sequences for d2py7x2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2py7x2 c.109.1.1 (X:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl nsenfvafnltermqliggtwyggemksgmfsmmnyllplkg
Timeline for d2py7x2: