SCOPe 2.01: Domain d2py7x1: 2py7 X:228-540

Lineage for d2py7x1 (2py7 X:228-540)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
   contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side

4. Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families)

5. Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (2 proteins)

6. Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (3 species)

7. Species Escherichia coli [TaxId:562] [53798] (10 PDB entries)

8. Domain d2py7x1: 2py7 X:228-540 [149933]
   Other proteins in same PDB: d2py7x2
   automatically matched to d1aq2a1
   complexed with atp, mg, mn; mutant

Details for d2py7x1

PDB Entry: 2py7, 2.2 Å

PDB Description: crystal structure of e. coli phosphoenolpyruvate carboxykinase mutant lys213ser complexed with atp-mg2+-mn2+

PDB Compounds: (X:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2py7x1:

Sequence; same for both SEQRES and ATOM records:

>d2py7x1 c.91.1.1 (X:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa
cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl
dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt
pagaalvaagpkl

Timeline for d2py7x1:

• d2py7x1 first appeared in SCOP 1.75
  
• d2py7x1 appears in SCOPe 2.02
  
• d2py7x1 appears in the current release, SCOPe 2.08