Lineage for d2py6a1 (2py6 A:14-408)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130507Family c.66.1.56: FkbM-like [159691] (1 protein)
    contains extra N-terminal alpha/beta and all-alpha subdomains
  6. 2130508Protein Methyltransferase FkbM [159692] (1 species)
  7. 2130509Species Methylobacillus flagellatus [TaxId:405] [159693] (1 PDB entry)
    Uniprot Q1GXX6 14-408
  8. 2130510Domain d2py6a1: 2py6 A:14-408 [149932]
    complexed with cl, edo, peg, unl

Details for d2py6a1

PDB Entry: 2py6 (more details), 2.15 Å

PDB Description: crystal structure of methyltransferase fkbm (yp_546752.1) from methylobacillus flagellatus kt at 2.20 a resolution
PDB Compounds: (A:) Methyltransferase FkbM

SCOPe Domain Sequences for d2py6a1:

Sequence, based on SEQRES records: (download)

>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]}
dplamndsflaaadalavdpmfgipanvreviarrgnatrlvilgtkgfgahlmnvrher
pceviaavddfryhsgelyyglpiistdrftelathdrdlvalntcrydgpkrffdqicr
thgiphlnfeqavrafglqgnvdyrvddwgadivrnipafqtlaqrladdysvqtlyavl
nfhltcepeyyheverpystlyfrsgllrfsdsekmvdcgasigeslagligvtkgkfer
vwmiepdrinlqtlqnvlrrytdtnfasritvhgcgagentirvpfnhegghggfvkpad
adhepadlidvrpiddiiddaptfikmdiegselsalkgarraisehkpklaisayhrst
dlldltnyilsirpdyqiglrhhtpdrwdtclyfy

Sequence, based on observed residues (ATOM records): (download)

>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]}
dplamndsflaaadalavdpmfgipanvreviarrgnatrlvilgtkgfgahlmnvrher
pceviaavddfryhsgelyyglpiistdrftelathdrdlvalntcrydgpkrffdqicr
thgiphlnfeqavrafglqgnvdyrvddwgadivrnipafqtlaqrladdysvqtlyavl
nfhltcepeyyheverpystlyfrsgllrfsdsekmvdcgasigeslagligvtkgkfer
vwmiepdrinlqtlqnvlrrytdtnfasritvhgcgagentirvpfdlidvrpiddiidd
aptfikmdiegselsalkgarraisehkpklaisayhrstdlldltnyilsirpdyqigl
rhhtpdrwdtclyfy

SCOPe Domain Coordinates for d2py6a1:

Click to download the PDB-style file with coordinates for d2py6a1.
(The format of our PDB-style files is described here.)

Timeline for d2py6a1: