SCOP 1.75: Domain d2py5a1: 2py5 A:5-187

Lineage for d2py5a1 (2py5 A:5-187)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
   Uniprot P03680

8. Domain d2py5a1: 2py5 A:5-187 [149928]
   Other proteins in same PDB: d2py5a2, d2py5b2
   automatically matched to d1xhxa1
   complexed with edo; mutant

Details for d2py5a1

PDB Entry: 2py5, 1.6 Å

PDB Description: phi29 dna polymerase complexed with single-stranded dna

PDB Compounds: (A:) DNA polymerase

SCOP Domain Sequences for d2py5a1:

Sequence; same for both SEQRES and ATOM records:

>d2py5a1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

Timeline for d2py5a1:

• d2py5a1 is new in SCOP 1.75
  
• d2py5a1 appears in SCOPe 2.01
  
• d2py5a1 appears in the current release, SCOPe 2.08