Lineage for d2py5a1 (2py5 A:5-187)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837032Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
    contains Pfam PF00929
  6. 837087Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)
  7. 837088Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
    Uniprot P03680
  8. 837089Domain d2py5a1: 2py5 A:5-187 [149928]
    Other proteins in same PDB: d2py5a2, d2py5b2
    automatically matched to d1xhxa1
    complexed with edo; mutant

Details for d2py5a1

PDB Entry: 2py5 (more details), 1.6 Å

PDB Description: phi29 dna polymerase complexed with single-stranded dna
PDB Compounds: (A:) DNA polymerase

SCOP Domain Sequences for d2py5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2py5a1 c.55.3.5 (A:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

SCOP Domain Coordinates for d2py5a1:

Click to download the PDB-style file with coordinates for d2py5a1.
(The format of our PDB-style files is described here.)

Timeline for d2py5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2py5a2