![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d2pxyd1: 2pxy D:94-191 [149924] Other proteins in same PDB: d2pxya_, d2pxyb_, d2pxyc1, d2pxyc2, d2pxyd2 automatically matched to d1f3jb1 |
PDB Entry: 2pxy (more details), 2.23 Å
SCOPe Domain Sequences for d2pxyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pxyd1 b.1.1.2 (D:94-191) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw tfqvlvmlemtprrgevytchvehpslkspitvewraq
Timeline for d2pxyd1:
![]() Domains from other chains: (mouse over for more information) d2pxya_, d2pxyb_, d2pxyc1, d2pxyc2 |