SCOPe 2.08: Domain d2pxyd1: 2pxy D:94-191

Lineage for d2pxyd1 (2pxy D:94-191)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2pxyd1: 2pxy D:94-191 [149924]
   Other proteins in same PDB: d2pxya_, d2pxyb_, d2pxyc1, d2pxyc2, d2pxyc3, d2pxyd2
   automatically matched to d1f3jb1

Details for d2pxyd1

PDB Entry: 2pxy, 2.23 Å

PDB Description: Crystal structures of immune receptor complexes

PDB Compounds: (D:) H-2 class II histocompatibility antigen, A-U beta chain

SCOPe Domain Sequences for d2pxyd1:

Sequence; same for both SEQRES and ATOM records:

>d2pxyd1 b.1.1.2 (D:94-191) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewraq

Timeline for d2pxyd1:

• d2pxyd1 first appeared in SCOP 1.75
  
• d2pxyd1 appears in SCOPe 2.07