| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.36: Signal peptide-binding domain [47445] (1 superfamily) 4 helices; orthogonal array |
Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) ![]() |
| Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins) |
| Protein Signal sequence binding protein Ffh [47448] (3 species) |
| Species Escherichia coli [TaxId:562] [47449] (14 PDB entries) |
| Domain d2pxva1: 2pxv A:1-82 [149921] automatically matched to d1hq1a_ protein/RNA complex; complexed with nco |
PDB Entry: 2pxv (more details), 2 Å
SCOPe Domain Sequences for d2pxva1:
Sequence, based on SEQRES records: (download)
>d2pxva1 a.36.1.1 (A:1-82) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm
>d2pxva1 a.36.1.1 (A:1-82) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
dmqrmmkkm
Timeline for d2pxva1: