SCOP 1.75: Domain d2pxua1: 2pxu A:1-82

Lineage for d2pxua1 (2pxu A:1-82)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Escherichia coli [TaxId:562] [47449] (13 PDB entries)

8. Domain d2pxua1: 2pxu A:1-82 [149920]
   automatically matched to d1hq1a_
   complexed with nco; mutant

Details for d2pxua1

PDB Entry: 2pxu, 2.5 Å

PDB Description: variant 16 of ribonucleoprotein core of the e. coli signal recognition particle

PDB Compounds: (A:) signal recognition particle protein

SCOP Domain Sequences for d2pxua1:

Sequence, based on SEQRES records:

>d2pxua1 a.36.1.1 (A:1-82) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm

Sequence, based on observed residues (ATOM records):

>d2pxua1 a.36.1.1 (A:1-82) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
dmqrmmkkm

Timeline for d2pxua1:

• d2pxua1 is new in SCOP 1.75
  
• d2pxua1 is called d2pxua_ in SCOPe 2.01
  
• d2pxua1 appears in the current release, SCOPe 2.08, called d2pxua_