![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.36: Signal peptide-binding domain [47445] (1 superfamily) 4 helices; orthogonal array |
![]() | Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) ![]() |
![]() | Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins) |
![]() | Protein Signal sequence binding protein Ffh [47448] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [47449] (14 PDB entries) |
![]() | Domain d2pxua_: 2pxu A: [149920] automated match to d1hq1a_ protein/RNA complex; complexed with nco |
PDB Entry: 2pxu (more details), 2.5 Å
SCOPe Domain Sequences for d2pxua_:
Sequence, based on SEQRES records: (download)
>d2pxua_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]} fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm
>d2pxua_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]} fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd dmqrmmkkm
Timeline for d2pxua_: