Lineage for d5hbia_ (5hbi A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin I [46464] (2 species) 
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (10 PDB entries) 
Domain d5hbia_: 5hbi A: [14992]
Details for d5hbia_
PDB Entry: 5hbi (more details), 1.6 Å
PDB Description: scapharca dimeric hemoglobin, mutant t72i, co-liganded form
SCOP Domain Sequences for d5hbia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hbia_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis)}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsiilmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal
SCOP Domain Coordinates for d5hbia_:
Click to download the PDB-style file with coordinates for d5hbia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hbia_:
- d5hbia_ appears in SCOP 1.57
- d5hbia_ appears in the current release, SCOPe 2.08
View in 3D
