SCOP 1.75: Domain d2pxrc1: 2pxr C:1-145

Lineage for d2pxrc1 (2pxr C:1-145)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (15 PDB entries)

8. Domain d2pxrc1: 2pxr C:1-145 [149918]
   automatically matched to d1l6na2
   complexed with cl, zn

Details for d2pxrc1

PDB Entry: 2pxr, 1.5 Å

PDB Description: Crystal Structure of HIV-1 CA146 in the Presence of CAP-1

PDB Compounds: (C:) Gag-Pol polyprotein (Pr160Gag-Pol)

SCOP Domain Sequences for d2pxrc1:

Sequence; same for both SEQRES and ATOM records:

>d2pxrc1 a.73.1.1 (C:1-145) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

Timeline for d2pxrc1:

• d2pxrc1 is new in SCOP 1.75
  
• d2pxrc1 is called d2pxrc_ in SCOPe 2.01
  
• d2pxrc1 appears in the current release, SCOPe 2.08, called d2pxrc_