Lineage for d2pxrc_ (2pxr C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2718011Protein automated matches [190369] (8 species)
    not a true protein
  7. 2718012Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)
  8. 2718013Domain d2pxrc_: 2pxr C: [149918]
    automated match to d1afva_
    complexed with cl, zn

Details for d2pxrc_

PDB Entry: 2pxr (more details), 1.5 Å

PDB Description: Crystal Structure of HIV-1 CA146 in the Presence of CAP-1
PDB Compounds: (C:) Gag-Pol polyprotein (Pr160Gag-Pol)

SCOPe Domain Sequences for d2pxrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pxrc_ a.73.1.1 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

SCOPe Domain Coordinates for d2pxrc_:

Click to download the PDB-style file with coordinates for d2pxrc_.
(The format of our PDB-style files is described here.)

Timeline for d2pxrc_: