SCOPe 2.08: Domain d2pxia2: 2pxi A:92-148

Lineage for d2pxia2 (2pxi A:92-148)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)

8. Domain d2pxia2: 2pxi A:92-148 [149912]
   Other proteins in same PDB: d2pxia1, d2pxia3
   automated match to d1tv9a2
   protein/DNA complex; complexed with cl, gfh, mg, na

Details for d2pxia2

PDB Entry: 2pxi, 2.1 Å

PDB Description: Ternary complex of DNA polymerase beta with a dideoxy terminated primer and 2'-deoxyguanosine 5'-beta, gamma-monofluoromethylene triphosphate

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d2pxia2:

Sequence; same for both SEQRES and ATOM records:

>d2pxia2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d2pxia2:

• d2pxia2 first appeared in SCOP 1.75
  
• d2pxia2 appears in SCOPe 2.07