Class a: All alpha proteins [46456] (284 folds) |
Fold a.36: Signal peptide-binding domain [47445] (1 superfamily) 4 helices; orthogonal array |
Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) |
Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins) |
Protein Signal sequence binding protein Ffh [47448] (3 species) |
Species Escherichia coli [TaxId:562] [47449] (13 PDB entries) |
Domain d2pxfa1: 2pxf A:1-82 [149910] automatically matched to d1hq1a_ complexed with nco; mutant |
PDB Entry: 2pxf (more details), 2 Å
SCOP Domain Sequences for d2pxfa1:
Sequence, based on SEQRES records: (download)
>d2pxfa1 a.36.1.1 (A:1-82) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]} fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm
>d2pxfa1 a.36.1.1 (A:1-82) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]} fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd dmqrmmkkm
Timeline for d2pxfa1: