SCOPe 2.05: Domain d4hbib_: 4hbi B:

Lineage for d4hbib_ (4hbi B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries)

8. Domain d4hbib_: 4hbi B: [14991]
   complexed with hem; mutant

Details for d4hbib_

PDB Entry: 4hbi, 1.6 Å

PDB Description: scapharca dimeric hemoglobin, mutant t72i, deoxy form

PDB Compounds: (B:) hemoglobin

SCOPe Domain Sequences for d4hbib_:

Sequence; same for both SEQRES and ATOM records:

>d4hbib_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsiilmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d4hbib_:

• d4hbib_ first appeared (with stable ids) in SCOP 1.55
  
• d4hbib_ appears in SCOPe 2.04
  
• d4hbib_ appears in SCOPe 2.06
  
• d4hbib_ appears in the current release, SCOPe 2.08