Lineage for d2pxea_ (2pxe A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709937Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 2709938Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) (S)
  5. 2709939Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 2709940Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 2709941Species Escherichia coli [TaxId:562] [47449] (14 PDB entries)
  8. 2709944Domain d2pxea_: 2pxe A: [149909]
    automated match to d1hq1a_
    protein/RNA complex; complexed with nco

Details for d2pxea_

PDB Entry: 2pxe (more details), 2 Å

PDB Description: variant 4 of ribonucleoprotein core of the e. coli signal recognition particle
PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2pxea_:

Sequence, based on SEQRES records: (download)

>d2pxea_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm

Sequence, based on observed residues (ATOM records): (download)

>d2pxea_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
dmqrmmkkm

SCOPe Domain Coordinates for d2pxea_:

Click to download the PDB-style file with coordinates for d2pxea_.
(The format of our PDB-style files is described here.)

Timeline for d2pxea_: