Lineage for d2pxba1 (2pxb A:1-82)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768356Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 768357Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. 768358Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 768359Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 768367Species Escherichia coli [TaxId:562] [47449] (13 PDB entries)
  8. 768371Domain d2pxba1: 2pxb A:1-82 [149907]
    automatically matched to d1hq1a_
    complexed with nco; mutant

Details for d2pxba1

PDB Entry: 2pxb (more details), 2 Å

PDB Description: variant 2 of ribonucleoprotein core of the e. coli signal recognition particle
PDB Compounds: (A:) signal recognition particle protein

SCOP Domain Sequences for d2pxba1:

Sequence, based on SEQRES records: (download)

>d2pxba1 a.36.1.1 (A:1-82) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm

Sequence, based on observed residues (ATOM records): (download)

>d2pxba1 a.36.1.1 (A:1-82) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
dmqrmmkkm

SCOP Domain Coordinates for d2pxba1:

Click to download the PDB-style file with coordinates for d2pxba1.
(The format of our PDB-style files is described here.)

Timeline for d2pxba1: