SCOPe 2.08: Domain d2pxba_: 2pxb A:

Lineage for d2pxba_ (2pxb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Escherichia coli [TaxId:562] [47449] (14 PDB entries)

8. Domain d2pxba_: 2pxb A: [149907]
   automated match to d1hq1a_
   protein/RNA complex; complexed with nco

Details for d2pxba_

PDB Entry: 2pxb, 2.5 Å

PDB Description: variant 2 of ribonucleoprotein core of the e. coli signal recognition particle

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2pxba_:

Sequence, based on SEQRES records:

>d2pxba_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm

Sequence, based on observed residues (ATOM records):

>d2pxba_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
dmqrmmkkm

Timeline for d2pxba_:

• d2pxba_ first appeared in SCOP 1.75, called d2pxba1
  
• d2pxba_ appears in SCOPe 2.07