Lineage for d2pwwa1 (2pww A:2-114)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2976282Superfamily d.129.11: YugN-like [160755] (2 families) (S)
  5. 2976283Family d.129.11.1: YugN-like [160756] (1 protein)
    Pfam PF08868
  6. 2976284Protein Uncharacterized protein ABC2387 [160757] (1 species)
    YugN homologue
  7. 2976285Species Bacillus clausii [TaxId:79880] [160758] (1 PDB entry)
    Uniprot Q5WFD8 1-114
  8. 2976286Domain d2pwwa1: 2pww A:2-114 [149905]
    Other proteins in same PDB: d2pwwa2
    complexed with edo

Details for d2pwwa1

PDB Entry: 2pww (more details), 1.82 Å

PDB Description: crystal structure of abc2387 from bacillus clausii
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2pwwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwwa1 d.129.11.1 (A:2-114) Uncharacterized protein ABC2387 {Bacillus clausii [TaxId: 79880]}
kfpdtgleekevafsivnhaakslgfihvdqwdyervmfdykivhhegtfylrvpayavk
geiprpstivqimtpilgkyyyphgveyegetfpqavidkcnnklallaktik

SCOPe Domain Coordinates for d2pwwa1:

Click to download the PDB-style file with coordinates for d2pwwa1.
(The format of our PDB-style files is described here.)

Timeline for d2pwwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pwwa2