Lineage for d2pw6a1 (2pw6 A:14-271)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2127228Superfamily c.56.6: LigB-like [53213] (1 family) (S)
    circular permutation of the common fold, most similar to the PNP fold
    automatically mapped to Pfam PF02900
  5. 2127229Family c.56.6.1: LigB-like [53214] (2 protein domains)
  6. 2127236Protein Uncharacterized protein YgiD [159657] (1 species)
  7. 2127237Species Escherichia coli [TaxId:562] [159658] (1 PDB entry)
    Uniprot P24197 14-271
  8. 2127238Domain d2pw6a1: 2pw6 A:14-271 [149895]
    complexed with zn

Details for d2pw6a1

PDB Entry: 2pw6 (more details), 2.27 Å

PDB Description: crystal structure of uncharacterized protein jw3007 from escherichia coli k12
PDB Compounds: (A:) Uncharacterized protein ygiD

SCOPe Domain Sequences for d2pw6a1:

Sequence, based on SEQRES records: (download)

>d2pw6a1 c.56.6.1 (A:14-271) Uncharacterized protein YgiD {Escherichia coli [TaxId: 562]}
rmpalflghgspmnvlednlytrswqklgmtlprpqaivvvsahwftrgtgvtametppt
ihdfggfpqalydthypapgspalaqrlvellapipvtldkeawgfdhgswgvlikmypd
adipmvqlsidsskpaawhfemgrklaalrdegimlvasgnvvhnlrtvkwhgdsspypw
atsfneyvkanltwqgpveqhplvnyldheggtlsnptpehylpllyvlgawdgqepiti
pvegiemgslsmlsvqig

Sequence, based on observed residues (ATOM records): (download)

>d2pw6a1 c.56.6.1 (A:14-271) Uncharacterized protein YgiD {Escherichia coli [TaxId: 562]}
rmpalflghgpmnvlednlytrswqklgmtlprpqaivvvsahwftrgtgvtametlydt
hypapgspalaqrlvellapipvtldkeawgfdhgswgvlikmypdadipmvqlsidssk
paawhfemgrklaalrdegimlvasgnvvhnlrtvkwhgdsspypwatsfneyvkanltw
qgpveqhplvnyldheggtlsnptpehylpllyvlgawdgqepitipvegiemgslsmls
vqig

SCOPe Domain Coordinates for d2pw6a1:

Click to download the PDB-style file with coordinates for d2pw6a1.
(The format of our PDB-style files is described here.)

Timeline for d2pw6a1: