Lineage for d2pvob1 (2pvo B:1-73)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796525Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 796547Family b.34.4.3: Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50098] (1 protein)
  6. 796548Protein Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain [50099] (1 species)
  7. 796549Species Synechocystis sp. [TaxId:1143] [50100] (5 PDB entries)
  8. 796555Domain d2pvob1: 2pvo B:1-73 [149892]
    Other proteins in same PDB: d2pvoa1
    automatically matched to d1dj7b_
    complexed with fes, sf4, so4; mutant

Details for d2pvob1

PDB Entry: 2pvo (more details), 3.4 Å

PDB Description: crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
PDB Compounds: (B:) Ferredoxin-thioredoxin reductase, variable chain

SCOP Domain Sequences for d2pvob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvob1 b.34.4.3 (B:1-73) Ferredoxin thioredoxin reductase (FTR), alpha (variable) chain {Synechocystis sp. [TaxId: 1143]}
mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
fkahfrpdevtli

SCOP Domain Coordinates for d2pvob1:

Click to download the PDB-style file with coordinates for d2pvob1.
(The format of our PDB-style files is described here.)

Timeline for d2pvob1: