Lineage for d4sdhb_ (4sdh B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin I [46464] (2 species) 
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (10 PDB entries) 
Domain d4sdhb_: 4sdh B: [14989]
Details for d4sdhb_
PDB Entry: 4sdh (more details), 1.6 Å
PDB Description: high resolution crystallographic analysis of a cooperative dimeric hemoglobin
SCOP Domain Sequences for d4sdhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4sdhb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis)}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal
SCOP Domain Coordinates for d4sdhb_:
Click to download the PDB-style file with coordinates for d4sdhb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4sdhb_:
- d4sdhb_ appears in SCOP 1.57
- d4sdhb_ appears in the current release, SCOPe 2.08
View in 3D
